PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_04682.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 159aa    MW: 18758.2 Da    PI: 9.9804
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_04682.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.11.2e-5571351129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWka 85 
                              +ppGfrFhPtdeelv++yL+kk+++++ +l +v+kevd+yk+ePwdL+ ++ a e++ewyfFs++d+ky+tg+r+nrat +g+Wka
  Sme2.5_04682.1_g00003.1   7 VPPGFRFHPTDEELVDYYLRKKINSTRSDL-DVVKEVDLYKIEPWDLQGRIGAeEQNEWYFFSHKDRKYPTGTRTNRATIAGFWKA 91 
                              69*************************999.99***************766662556***************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              tg+dk+++s+ +el+g++ktLvfykgrap+g k+dW+mheyrle
  Sme2.5_04682.1_g00003.1  92 TGRDKAIYSRAHELIGMRKTLVFYKGRAPHGLKSDWIMHEYRLE 135
                              ******************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-565139IPR003441NAC domain
PROSITE profilePS5100554.1657159IPR003441NAC domain
PfamPF023651.4E-288134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MNSFSHVPPG FRFHPTDEEL VDYYLRKKIN STRSDLDVVK EVDLYKIEPW DLQGRIGAEE  60
QNEWYFFSHK DRKYPTGTRT NRATIAGFWK ATGRDKAIYS RAHELIGMRK TLVFYKGRAP  120
HGLKSDWIMH EYRLETHPNA VPQASCSSNS NFFSRKHFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-48613414140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754424e-84HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755154e-84HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009599621.17e-89PREDICTED: NAC domain-containing protein 7-like
RefseqXP_009773837.16e-89PREDICTED: NAC domain-containing protein 7-like
RefseqXP_016444884.17e-89PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX22e-83NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A067DZX04e-88A0A067DZX0_CITSI; Uncharacterized protein (Fragment)
STRINGGLYMA09G36600.12e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-84NAC 007